![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
![]() | Family c.23.5.3: Quinone reductase [52235] (4 proteins) binds FAD |
![]() | Protein ACP phosphodiesterase AcpD [110470] (2 species) evolved new enzymatic activity |
![]() | Species Escherichia coli [TaxId:562] [110471] (7 PDB entries) Uniprot P41407 |
![]() | Domain d1tika1: 1tik A:4-203 [107003] Other proteins in same PDB: d1tika2, d1tika3 Structural genomics target complexed with so4 |
PDB Entry: 1tik (more details), 2.3 Å
SCOPe Domain Sequences for d1tika1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tika1 c.23.5.3 (A:4-203) ACP phosphodiesterase AcpD {Escherichia coli [TaxId: 562]} skvlvlkssilagysqsnqlsdyfveqwrekhsadeitvrdlaanpipvldgelvgalrp sdapltprqqealalsdeliaelkahdviviaapmynfnistqlknyfdlvaragvtfry tengpeglvtgkkaivitsrggihkdgptdlvtpylstflgfigitdvkfvfaegiaygp emaakaqsdakaaidsivsa
Timeline for d1tika1: