Lineage for d1tidb_ (1tid B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1835156Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
    core: 4 turns of a (beta-alpha)n superhelix
  4. 1835204Superfamily c.13.2: SpoIIaa-like [52091] (2 families) (S)
  5. 1835205Family c.13.2.1: Anti-sigma factor antagonist SpoIIaa [52092] (1 protein)
    automatically mapped to Pfam PF01740
  6. 1835206Protein Anti-sigma factor antagonist SpoIIaa [52093] (4 species)
  7. 1835213Species Bacillus stearothermophilus [TaxId:1422] [110448] (4 PDB entries)
    Uniprot O32726 # 90% sequence identity
  8. 1835215Domain d1tidb_: 1tid B: [107000]
    Other proteins in same PDB: d1tida_, d1tidc_
    complexed with atp, mg

Details for d1tidb_

PDB Entry: 1tid (more details), 2.5 Å

PDB Description: Crystal Structures of the ADP and ATP bound forms of the Bacillus Anti-sigma factor SpoIIAB in complex with the Anti-anti-sigma SpoIIAA: Poised for phosphorylation complex with ATP, crystal form I
PDB Compounds: (B:) anti-sigma f factor antagonist

SCOPe Domain Sequences for d1tidb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tidb_ c.13.2.1 (B:) Anti-sigma factor antagonist SpoIIaa {Bacillus stearothermophilus [TaxId: 1422]}
gshmslaidlevkqdvlivrlsgeldhhtaeelreqvtdvlenrairhivlnlgqltfmd
asglgvilgrykqiknvggqmvvcavspavkrlfdmsglfkiirveadeqfalqalgva

SCOPe Domain Coordinates for d1tidb_:

Click to download the PDB-style file with coordinates for d1tidb_.
(The format of our PDB-style files is described here.)

Timeline for d1tidb_: