SCOPe 2.06: Domain d1ti6j1: 1ti6 J:196-274

Lineage for d1ti6j1 (1ti6 J:196-274)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.5: Cna protein B-type domain [49478] (2 families)

5. Family b.3.5.1: Cna protein B-type domain [49479] (4 proteins)
   Pfam PF05738

6. Protein Transhydroxylase beta subunit, BthL, C-terminal domain [110094] (1 species)
   the penultimate strand is in the other beta-sheet than in the Cna repeats

7. Species Pelobacter acidigallici [TaxId:35816] [110095] (6 PDB entries)
   Uniprot P80564

8. Domain d1ti6j1: 1ti6 J:196-274 [106992]
   Other proteins in same PDB: d1ti6a1, d1ti6a2, d1ti6b2, d1ti6c1, d1ti6c2, d1ti6d2, d1ti6e1, d1ti6e2, d1ti6f2, d1ti6g1, d1ti6g2, d1ti6h2, d1ti6i1, d1ti6i2, d1ti6j2, d1ti6k1, d1ti6k2, d1ti6l2
   complexed with 4mo, btt, ca, mgd, sf4
   complexed with 4mo, btt, ca, mgd, sf4

Details for d1ti6j1

PDB Entry: 1ti6, 2 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with inhibitor 1,2,4,5-tetrahydroxy-benzene

PDB Compounds: (J:) Pyrogallol hydroxytransferase small subunit

SCOPe Domain Sequences for d1ti6j1:

Sequence; same for both SEQRES and ATOM records:

>d1ti6j1 b.3.5.1 (J:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici [TaxId: 35816]}
knyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdaldngeytveidadgks
ysdtvviddksvdlgfikl

Timeline for d1ti6j1:

• d1ti6j1 first appeared in SCOP 1.69
  
• d1ti6j1 appears in SCOPe 2.05
  
• d1ti6j1 appears in SCOPe 2.07
  
• d1ti6j1 appears in the current release, SCOPe 2.08