Lineage for d1ti4l2 (1ti4 L:1-195)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 723374Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 723475Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (11 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 723566Protein Transhydroxylase beta subunit, BthL, N-terminal domain [110948] (1 species)
  7. 723567Species Pelobacter acidigallici [TaxId:35816] [110949] (6 PDB entries)
  8. 723591Domain d1ti4l2: 1ti4 L:1-195 [106973]
    Other proteins in same PDB: d1ti4a1, d1ti4a2, d1ti4b1, d1ti4c1, d1ti4c2, d1ti4d1, d1ti4e1, d1ti4e2, d1ti4f1, d1ti4g1, d1ti4g2, d1ti4h1, d1ti4i1, d1ti4i2, d1ti4j1, d1ti4k1, d1ti4k2, d1ti4l1
    complexed with 4mo, ca, fs4, mgd, pyg

Details for d1ti4l2

PDB Entry: 1ti4 (more details), 2.2 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with pyrogallol
PDB Compounds: (L:) Pyrogallol hydroxytransferase small subunit

SCOP Domain Sequences for d1ti4l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ti4l2 d.58.1.5 (L:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]}
meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
gtkprvyyknlyrfe

SCOP Domain Coordinates for d1ti4l2:

Click to download the PDB-style file with coordinates for d1ti4l2.
(The format of our PDB-style files is described here.)

Timeline for d1ti4l2: