SCOP 1.69: Domain d1ti2h1: 1ti2 H:196-274

Lineage for d1ti2h1 (1ti2 H:196-274)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.3: Prealbumin-like [49451] (6 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.5: Cna protein B-type domain (Pfam 05738) [49478] (1 family)

5. Family b.3.5.1: Cna protein B-type domain (Pfam 05738) [49479] (2 proteins)

6. Protein Transhydroxylase beta subunit, BthL, C-terminal domain [110094] (1 species)
   the penultimate strand is in the other beta-sheet than in the Cna repeats

7. Species Pelobacter acidigallici [TaxId:35816] [110095] (6 PDB entries)

8. Domain d1ti2h1: 1ti2 H:196-274 [106940]
   Other proteins in same PDB: d1ti2a1, d1ti2a2, d1ti2b2, d1ti2c1, d1ti2c2, d1ti2d2, d1ti2e1, d1ti2e2, d1ti2f2, d1ti2g1, d1ti2g2, d1ti2h2, d1ti2i1, d1ti2i2, d1ti2j2, d1ti2k1, d1ti2k2, d1ti2l2

Details for d1ti2h1

PDB Entry: 1ti2, 2.35 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici

SCOP Domain Sequences for d1ti2h1:

Sequence; same for both SEQRES and ATOM records:

>d1ti2h1 b.3.5.1 (H:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici}
knyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdaldngeytveidadgks
ysdtvviddksvdlgfikl

Timeline for d1ti2h1:

• d1ti2h1 is new in SCOP 1.69
  
• d1ti2h1 appears in SCOP 1.71
  
• d1ti2h1 appears in the current release, SCOPe 2.08