Lineage for d1ti2d2 (1ti2 D:1-195)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2192664Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2192801Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 2192945Protein Transhydroxylase beta subunit, BthL, N-terminal domain [110948] (1 species)
  7. 2192946Species Pelobacter acidigallici [TaxId:35816] [110949] (6 PDB entries)
    Uniprot P80564
  8. 2192972Domain d1ti2d2: 1ti2 D:1-195 [106933]
    Other proteins in same PDB: d1ti2a1, d1ti2a2, d1ti2b1, d1ti2c1, d1ti2c2, d1ti2d1, d1ti2e1, d1ti2e2, d1ti2f1, d1ti2g1, d1ti2g2, d1ti2h1, d1ti2i1, d1ti2i2, d1ti2j1, d1ti2k1, d1ti2k2, d1ti2l1
    complexed with 4mo, act, ca, mgd, sf4
    complexed with 4mo, act, ca, mgd, sf4

Details for d1ti2d2

PDB Entry: 1ti2 (more details), 2.35 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici
PDB Compounds: (D:) Pyrogallol hydroxytransferase small subunit

SCOPe Domain Sequences for d1ti2d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ti2d2 d.58.1.5 (D:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]}
meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
gtkprvyyknlyrfe

SCOPe Domain Coordinates for d1ti2d2:

Click to download the PDB-style file with coordinates for d1ti2d2.
(The format of our PDB-style files is described here.)

Timeline for d1ti2d2: