Lineage for d1ti2b1 (1ti2 B:196-274)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 457077Fold b.3: Prealbumin-like [49451] (6 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 457366Superfamily b.3.5: Cna protein B-type domain (Pfam 05738) [49478] (1 family) (S)
  5. 457367Family b.3.5.1: Cna protein B-type domain (Pfam 05738) [49479] (2 proteins)
  6. 457378Protein Transhydroxylase beta subunit, BthL, C-terminal domain [110094] (1 species)
    the penultimate strand is in the other beta-sheet than in the Cna repeats
  7. 457379Species Pelobacter acidigallici [TaxId:35816] [110095] (6 PDB entries)
  8. 457404Domain d1ti2b1: 1ti2 B:196-274 [106928]
    Other proteins in same PDB: d1ti2a1, d1ti2a2, d1ti2b2, d1ti2c1, d1ti2c2, d1ti2d2, d1ti2e1, d1ti2e2, d1ti2f2, d1ti2g1, d1ti2g2, d1ti2h2, d1ti2i1, d1ti2i2, d1ti2j2, d1ti2k1, d1ti2k2, d1ti2l2

Details for d1ti2b1

PDB Entry: 1ti2 (more details), 2.35 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici

SCOP Domain Sequences for d1ti2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ti2b1 b.3.5.1 (B:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici}
knyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdaldngeytveidadgks
ysdtvviddksvdlgfikl

SCOP Domain Coordinates for d1ti2b1:

Click to download the PDB-style file with coordinates for d1ti2b1.
(The format of our PDB-style files is described here.)

Timeline for d1ti2b1: