SCOPe 2.05: Domain d1thzb1: 1thz B:4-200

Lineage for d1thzb1 (1thz B:4-200)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families)
   contains a common phosphate-binding site

5. Family c.24.1.3: Inosicase [63971] (1 protein)

6. Protein IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC [63972] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [63973] (8 PDB entries)
   Uniprot P31335

8. Domain d1thzb1: 1thz B:4-200 [106923]
   Other proteins in same PDB: d1thza2, d1thzb2
   complexed with 326, k

Details for d1thzb1

PDB Entry: 1thz, 1.8 Å

PDB Description: Crystal Structure of Avian AICAR Transformylase in Complex with a Novel Inhibitor Identified by Virtual Ligand Screening

PDB Compounds: (B:) Bifunctional purine biosynthesis protein PURH

SCOPe Domain Sequences for d1thzb1:

Sequence; same for both SEQRES and ATOM records:

>d1thzb1 c.24.1.3 (B:4-200) IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus) [TaxId: 9031]}
rqqlallsvsekaglvefarslnalglgliasggtatalrdaglpvrdvsdltgfpemlg
grvktlhpavhagilarnipednadmnkqdfslvrvvvcnlypfvktvsspgvtvpeave
kidiggvallraaaknharvtvvcdpadyssvakemaaskdkdtsvetrrhlalkaftht
aqydaaisdyfrkeysk

Timeline for d1thzb1:

• d1thzb1 first appeared in SCOP 1.69
  
• d1thzb1 appears in SCOPe 2.04
  
• d1thzb1 appears in SCOPe 2.06
  
• d1thzb1 appears in the current release, SCOPe 2.08