Lineage for d1thza2 (1thz A:201-593)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 495641Fold c.97: Cytidine deaminase-like [53926] (3 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 2 is antiparallel to the rest
  4. 495691Superfamily c.97.2: AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64197] (1 family) (S)
    duplication: consists of two domains of this fold with extra secondary structures within and in between the two core motifs
  5. 495692Family c.97.2.1: AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64198] (1 protein)
  6. 495693Protein AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64199] (2 species)
  7. 495694Species Chicken (Gallus gallus) [TaxId:9031] [64200] (4 PDB entries)
  8. 495697Domain d1thza2: 1thz A:201-593 [106922]
    Other proteins in same PDB: d1thza1, d1thzb1

Details for d1thza2

PDB Entry: 1thz (more details), 1.8 Å

PDB Description: Crystal Structure of Avian AICAR Transformylase in Complex with a Novel Inhibitor Identified by Virtual Ligand Screening

SCOP Domain Sequences for d1thza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1thza2 c.97.2.1 (A:201-593) AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus)}
gvsqlplrygmnphqspaqlyttrpklpltvvngspgfinlcdalnawqlvkelkqalgi
paaasfkhvspagaavgiplseeeaqvcmvhdlhktltplasayarsrgadrmssfgdfi
alsdicdvptakiisrevsdgvvapgyeeealkilskkknggycvlqmdpnyepddneir
tlyglqlmqkrnnavidrslfknivtknktlpesavrdlivasiavkytqsnsvcyakdg
qvigigagqqsrihctrlagdkanswwlrhhprvlsmkfkagvkraevsnaidqyvtgti
gededlvkwqamfeevpaqlteaekkqwiakltavslssdaffpfrdnvdrakrigvqfi
vapsgsaadevvieacnelgitlihtnlrlfhh

SCOP Domain Coordinates for d1thza2:

Click to download the PDB-style file with coordinates for d1thza2.
(The format of our PDB-style files is described here.)

Timeline for d1thza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1thza1