Lineage for d1thqa_ (1thq A:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1955624Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 1955625Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 1955647Family f.4.1.2: Outer membrane enzyme PagP [82874] (2 proteins)
    automatically mapped to Pfam PF07017
  6. 1955648Protein Outer membrane enzyme PagP [82875] (1 species)
  7. 1955649Species Escherichia coli [TaxId:562] [82876] (3 PDB entries)
    Uniprot Q7C2L2
  8. 1955650Domain d1thqa_: 1thq A: [106920]
    complexed with act, lda, mpd

Details for d1thqa_

PDB Entry: 1thq (more details), 1.9 Å

PDB Description: Crystal Structure of Outer Membrane Enzyme PagP
PDB Compounds: (A:) CrcA protein

SCOPe Domain Sequences for d1thqa_:

Sequence, based on SEQRES records: (download)

>d1thqa_ f.4.1.2 (A:) Outer membrane enzyme PagP {Escherichia coli [TaxId: 562]}
ttfreniaqtwqqpehydlyipaitwharfaydkektdrynerpwgggfglsrwdekgnw
hglyamafkdswnkwepiagygwestwrpladenfhlglgftagvtardnwnyiplpvll
plasvgygpvtfqmtyipgtynngnvyfawmrfqfle

Sequence, based on observed residues (ATOM records): (download)

>d1thqa_ f.4.1.2 (A:) Outer membrane enzyme PagP {Escherichia coli [TaxId: 562]}
ttfreniaqtwqqpehydlyipaitwharfaerpwgggfglsrwdekgnwhglyamafkd
swnkwepiagygwestwrpladenfhlglgftagvtardnwnyiplpvllplasvgygpv
tfqmtyipgtynngnvyfawmrfqfle

SCOPe Domain Coordinates for d1thqa_:

Click to download the PDB-style file with coordinates for d1thqa_.
(The format of our PDB-style files is described here.)

Timeline for d1thqa_: