Lineage for d1thqa_ (1thq A:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519206Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 519207Superfamily f.4.1: OMPA-like [56925] (2 families) (S)
    forms (8,10) barrel
  5. 519224Family f.4.1.2: Outer membrane enzyme PagP [82874] (1 protein)
  6. 519225Protein Outer membrane enzyme PagP [82875] (1 species)
  7. 519226Species Escherichia coli [TaxId:562] [82876] (3 PDB entries)
  8. 519227Domain d1thqa_: 1thq A: [106920]

Details for d1thqa_

PDB Entry: 1thq (more details), 1.9 Å

PDB Description: Crystal Structure of Outer Membrane Enzyme PagP

SCOP Domain Sequences for d1thqa_:

Sequence, based on SEQRES records: (download)

>d1thqa_ f.4.1.2 (A:) Outer membrane enzyme PagP {Escherichia coli}
ttfreniaqtwqqpehydlyipaitwharfaydkektdrynerpwgggfglsrwdekgnw
hglyamafkdswnkwepiagygwestwrpladenfhlglgftagvtardnwnyiplpvll
plasvgygpvtfqmtyipgtynngnvyfawmrfqfle

Sequence, based on observed residues (ATOM records): (download)

>d1thqa_ f.4.1.2 (A:) Outer membrane enzyme PagP {Escherichia coli}
ttfreniaqtwqqpehydlyipaitwharfaerpwgggfglsrwdekgnwhglyamafkd
swnkwepiagygwestwrpladenfhlglgftagvtardnwnyiplpvllplasvgygpv
tfqmtyipgtynngnvyfawmrfqfle

SCOP Domain Coordinates for d1thqa_:

Click to download the PDB-style file with coordinates for d1thqa_.
(The format of our PDB-style files is described here.)

Timeline for d1thqa_: