SCOPe 2.08: Domain d1thqa1: 1thq A:7-161

Lineage for d1thqa1 (1thq A:7-161)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.4.1: OMPA-like [56925] (5 families)
   forms (8,10) barrel

5. Family f.4.1.2: Outer membrane enzyme PagP [82874] (2 proteins)
   automatically mapped to Pfam PF07017

6. Protein Outer membrane enzyme PagP [82875] (1 species)

7. Species Escherichia coli [TaxId:562] [82876] (3 PDB entries)
   Uniprot Q7C2L2

8. Domain d1thqa1: 1thq A:7-161 [106920]
   Other proteins in same PDB: d1thqa2
   complexed with act, lda, mpd

Details for d1thqa1

PDB Entry: 1thq, 1.9 Å

PDB Description: Crystal Structure of Outer Membrane Enzyme PagP

PDB Compounds: (A:) CrcA protein

SCOPe Domain Sequences for d1thqa1:

Sequence, based on SEQRES records:

>d1thqa1 f.4.1.2 (A:7-161) Outer membrane enzyme PagP {Escherichia coli [TaxId: 562]}
ttfreniaqtwqqpehydlyipaitwharfaydkektdrynerpwgggfglsrwdekgnw
hglyamafkdswnkwepiagygwestwrpladenfhlglgftagvtardnwnyiplpvll
plasvgygpvtfqmtyipgtynngnvyfawmrfqf

Sequence, based on observed residues (ATOM records):

>d1thqa1 f.4.1.2 (A:7-161) Outer membrane enzyme PagP {Escherichia coli [TaxId: 562]}
ttfreniaqtwqqpehydlyipaitwharfaerpwgggfglsrwdekgnwhglyamafkd
swnkwepiagygwestwrpladenfhlglgftagvtardnwnyiplpvllplasvgygpv
tfqmtyipgtynngnvyfawmrfqf

Timeline for d1thqa1:

• d1thqa1 first appeared in SCOP 1.69, called d1thqa_
  
• d1thqa1 appears in SCOPe 2.07