Lineage for d1thnd_ (1thn D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852201Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
    core: 4 turns of a (beta-alpha)n superhelix
  4. 2852253Superfamily c.13.2: SpoIIaa-like [52091] (3 families) (S)
  5. 2852254Family c.13.2.1: Anti-sigma factor antagonist SpoIIaa [52092] (1 protein)
    automatically mapped to Pfam PF01740
  6. 2852255Protein Anti-sigma factor antagonist SpoIIaa [52093] (4 species)
  7. 2852262Species Bacillus stearothermophilus [TaxId:1422] [110448] (4 PDB entries)
    Uniprot O32726 # 90% sequence identity
  8. 2852267Domain d1thnd_: 1thn D: [106919]
    Other proteins in same PDB: d1thna1, d1thna2, d1thnc1, d1thnc2
    complexed with adp, dmf

Details for d1thnd_

PDB Entry: 1thn (more details), 2.5 Å

PDB Description: Crystal Structures of the ADP and ATP bound forms of the Bacillus Anti-sigma factor SpoIIAB in complex with the Anti-anti-sigma SpoIIAA: inhibitory complex with ADP, crystal form I
PDB Compounds: (D:) anti-sigma f factor antagonist

SCOPe Domain Sequences for d1thnd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1thnd_ c.13.2.1 (D:) Anti-sigma factor antagonist SpoIIaa {Bacillus stearothermophilus [TaxId: 1422]}
slaidlevkqdvlivrlsgeldhhtaeelreqvtdvlenrairhivlnlgqltfmdssgl
gvilgrykqiknvggqmvvcavspavkrlfdmsglfkiirveadeqfalqalgva

SCOPe Domain Coordinates for d1thnd_:

Click to download the PDB-style file with coordinates for d1thnd_.
(The format of our PDB-style files is described here.)

Timeline for d1thnd_: