SCOPe 2.08: Domain d1thnd_: 1thn D:

Lineage for d1thnd_ (1thn D:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
   core: 4 turns of a (beta-alpha)n superhelix

4. Superfamily c.13.2: SpoIIaa-like [52091] (3 families)

5. Family c.13.2.1: Anti-sigma factor antagonist SpoIIaa [52092] (1 protein)
   automatically mapped to Pfam PF01740

6. Protein Anti-sigma factor antagonist SpoIIaa [52093] (4 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [110448] (4 PDB entries)
   Uniprot O32726 # 90% sequence identity

8. Domain d1thnd_: 1thn D: [106919]
   Other proteins in same PDB: d1thna1, d1thna2, d1thnc1, d1thnc2
   complexed with adp, dmf

Details for d1thnd_

PDB Entry: 1thn, 2.5 Å

PDB Description: Crystal Structures of the ADP and ATP bound forms of the Bacillus Anti-sigma factor SpoIIAB in complex with the Anti-anti-sigma SpoIIAA: inhibitory complex with ADP, crystal form I

PDB Compounds: (D:) anti-sigma f factor antagonist

SCOPe Domain Sequences for d1thnd_:

Sequence; same for both SEQRES and ATOM records:

>d1thnd_ c.13.2.1 (D:) Anti-sigma factor antagonist SpoIIaa {Bacillus stearothermophilus [TaxId: 1422]}
slaidlevkqdvlivrlsgeldhhtaeelreqvtdvlenrairhivlnlgqltfmdssgl
gvilgrykqiknvggqmvvcavspavkrlfdmsglfkiirveadeqfalqalgva

Timeline for d1thnd_:

• d1thnd_ first appeared in SCOP 1.69
  
• d1thnd_ appears in SCOPe 2.07