Lineage for d1thnc_ (1thn C:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 510439Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 510440Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 510532Family d.122.1.3: Histidine kinase [55884] (5 proteins)
  6. 510533Protein Anti-sigma factor spoIIab [75535] (1 species)
  7. 510534Species Bacillus stearothermophilus [TaxId:1422] [75536] (5 PDB entries)
  8. 510539Domain d1thnc_: 1thn C: [106918]
    Other proteins in same PDB: d1thnb_, d1thnd_

Details for d1thnc_

PDB Entry: 1thn (more details), 2.5 Å

PDB Description: Crystal Structures of the ADP and ATP bound forms of the Bacillus Anti-sigma factor SpoIIAB in complex with the Anti-anti-sigma SpoIIAA: inhibitory complex with ADP, crystal form I

SCOP Domain Sequences for d1thnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1thnc_ d.122.1.3 (C:) Anti-sigma factor spoIIab {Bacillus stearothermophilus}
rnemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndpn
givsisviiedgvvhltvrdegvgipdieearqplfttkpelersgmgftimenfmdevi
vesevnkgttvylkkh

SCOP Domain Coordinates for d1thnc_:

Click to download the PDB-style file with coordinates for d1thnc_.
(The format of our PDB-style files is described here.)

Timeline for d1thnc_: