Lineage for d1thnc1 (1thn C:2-136)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537076Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2537077Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2537568Family d.122.1.3: Histidine kinase [55884] (8 proteins)
  6. 2537569Protein Anti-sigma factor spoIIab [75535] (1 species)
  7. 2537570Species Bacillus stearothermophilus [TaxId:1422] [75536] (5 PDB entries)
    Uniprot O32727
  8. 2537575Domain d1thnc1: 1thn C:2-136 [106918]
    Other proteins in same PDB: d1thna2, d1thnb_, d1thnc2, d1thnd_
    complexed with adp, dmf

Details for d1thnc1

PDB Entry: 1thn (more details), 2.5 Å

PDB Description: Crystal Structures of the ADP and ATP bound forms of the Bacillus Anti-sigma factor SpoIIAB in complex with the Anti-anti-sigma SpoIIAA: inhibitory complex with ADP, crystal form I
PDB Compounds: (C:) Anti-sigma F factor

SCOPe Domain Sequences for d1thnc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1thnc1 d.122.1.3 (C:2-136) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]}
rnemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndpn
givsisviiedgvvhltvrdegvgipdieearqplfttkpelersgmgftimenfmdevi
vesevnkgttvylkk

SCOPe Domain Coordinates for d1thnc1:

Click to download the PDB-style file with coordinates for d1thnc1.
(The format of our PDB-style files is described here.)

Timeline for d1thnc1: