Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.13: SpoIIaa-like [52086] (2 superfamilies) core: 4 turns of a (beta-alpha)n superhelix |
Superfamily c.13.2: Anti-sigma factor antagonist SpoIIaa [52091] (1 family) |
Family c.13.2.1: Anti-sigma factor antagonist SpoIIaa [52092] (1 protein) |
Protein Anti-sigma factor antagonist SpoIIaa [52093] (4 species) |
Species Bacillus stearothermophilus [TaxId:1422] [110448] (4 PDB entries) |
Domain d1thnb_: 1thn B: [106917] Other proteins in same PDB: d1thna_, d1thnc_ |
PDB Entry: 1thn (more details), 2.5 Å
SCOP Domain Sequences for d1thnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1thnb_ c.13.2.1 (B:) Anti-sigma factor antagonist SpoIIaa {Bacillus stearothermophilus} slaidlevkqdvlivrlsgeldhhtaeelreqvtdvlenrairhivlnlgqltfmdssgl gvilgrykqiknvggqmvvcavspavkrlfdmsglfkiirveadeqfalqalgv
Timeline for d1thnb_: