SCOP 1.71: Domain d1thnb_: 1thn B:

Lineage for d1thnb_ (1thn B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
   core: 4 turns of a (beta-alpha)n superhelix

4. Superfamily c.13.2: Anti-sigma factor antagonist SpoIIaa [52091] (1 family)

5. Family c.13.2.1: Anti-sigma factor antagonist SpoIIaa [52092] (1 protein)

6. Protein Anti-sigma factor antagonist SpoIIaa [52093] (4 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [110448] (4 PDB entries)

8. Domain d1thnb_: 1thn B: [106917]
   Other proteins in same PDB: d1thna_, d1thnc_

Details for d1thnb_

PDB Entry: 1thn, 2.5 Å

PDB Description: Crystal Structures of the ADP and ATP bound forms of the Bacillus Anti-sigma factor SpoIIAB in complex with the Anti-anti-sigma SpoIIAA: inhibitory complex with ADP, crystal form I

SCOP Domain Sequences for d1thnb_:

Sequence; same for both SEQRES and ATOM records:

>d1thnb_ c.13.2.1 (B:) Anti-sigma factor antagonist SpoIIaa {Bacillus stearothermophilus}
slaidlevkqdvlivrlsgeldhhtaeelreqvtdvlenrairhivlnlgqltfmdssgl
gvilgrykqiknvggqmvvcavspavkrlfdmsglfkiirveadeqfalqalgv

Timeline for d1thnb_:

• d1thnb_ first appeared in SCOP 1.69
  
• d1thnb_ appears in SCOP 1.73
  
• d1thnb_ appears in the current release, SCOPe 2.08