SCOP 1.71: Domain d1thna_: 1thn A:

Lineage for d1thna_ (1thn A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families)

5. Family d.122.1.3: Histidine kinase [55884] (5 proteins)

6. Protein Anti-sigma factor spoIIab [75535] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [75536] (5 PDB entries)

8. Domain d1thna_: 1thn A: [106916]
   Other proteins in same PDB: d1thnb_, d1thnd_

Details for d1thna_

PDB Entry: 1thn, 2.5 Å

PDB Description: Crystal Structures of the ADP and ATP bound forms of the Bacillus Anti-sigma factor SpoIIAB in complex with the Anti-anti-sigma SpoIIAA: inhibitory complex with ADP, crystal form I

SCOP Domain Sequences for d1thna_:

Sequence; same for both SEQRES and ATOM records:

>d1thna_ d.122.1.3 (A:) Anti-sigma factor spoIIab {Bacillus stearothermophilus}
rnemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndpn
givsisviiedgvvhltvrdegvgipdieearqplfttkpelersgmgftimenfmdevi
vesevnkgttvylkkh

Timeline for d1thna_:

• d1thna_ first appeared in SCOP 1.69
  
• d1thna_ appears in SCOP 1.73
  
• d1thna_ appears in the current release, SCOPe 2.08, called d1thna1