Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.3: Histidine kinase [55884] (8 proteins) |
Protein Anti-sigma factor spoIIab [75535] (1 species) |
Species Bacillus stearothermophilus [TaxId:1422] [75536] (5 PDB entries) Uniprot O32727 |
Domain d1th8a1: 1th8 A:1-136 [106908] Other proteins in same PDB: d1th8a2, d1th8b_ complexed with adp, mg |
PDB Entry: 1th8 (more details), 2.4 Å
SCOPe Domain Sequences for d1th8a1:
Sequence, based on SEQRES records: (download)
>d1th8a1 d.122.1.3 (A:1-136) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]} mrnemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndp ngivsisviiedgvvhltvrdegvgipdieearqplfttkpelersgmgftimenfmdev ivesevnkgttvylkk
>d1th8a1 d.122.1.3 (A:1-136) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]} mrnemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndp ngivsisviiedgvvhltvrdegvgipdieearqplersgmgftimenfmdevivesevn kgttvylkk
Timeline for d1th8a1: