Lineage for d1th8a1 (1th8 A:1-136)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579776Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2579777Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2580397Family d.122.1.3: Histidine kinase [55884] (8 proteins)
  6. 2580398Protein Anti-sigma factor spoIIab [75535] (1 species)
  7. 2580399Species Bacillus stearothermophilus [TaxId:1422] [75536] (5 PDB entries)
    Uniprot O32727
  8. 2580400Domain d1th8a1: 1th8 A:1-136 [106908]
    Other proteins in same PDB: d1th8a2, d1th8b_
    complexed with adp, mg

Details for d1th8a1

PDB Entry: 1th8 (more details), 2.4 Å

PDB Description: Crystal Structures of the ADP and ATP bound forms of the Bacillus Anti-sigma factor SpoIIAB in complex with the Anti-anti-sigma SpoIIAA: inhibitory complex with ADP, crystal form II
PDB Compounds: (A:) Anti-sigma F factor

SCOPe Domain Sequences for d1th8a1:

Sequence, based on SEQRES records: (download)

>d1th8a1 d.122.1.3 (A:1-136) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]}
mrnemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndp
ngivsisviiedgvvhltvrdegvgipdieearqplfttkpelersgmgftimenfmdev
ivesevnkgttvylkk

Sequence, based on observed residues (ATOM records): (download)

>d1th8a1 d.122.1.3 (A:1-136) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]}
mrnemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndp
ngivsisviiedgvvhltvrdegvgipdieearqplersgmgftimenfmdevivesevn
kgttvylkk

SCOPe Domain Coordinates for d1th8a1:

Click to download the PDB-style file with coordinates for d1th8a1.
(The format of our PDB-style files is described here.)

Timeline for d1th8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1th8a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1th8b_