![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
![]() | Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) ![]() |
![]() | Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) |
![]() | Protein Snake phospholipase A2 [48624] (35 species) |
![]() | Species Snake (Daboia russelli pulchella) [48630] (26 PDB entries) |
![]() | Domain d1th6a_: 1th6 A: [106907] |
PDB Entry: 1th6 (more details), 1.23 Å
SCOP Domain Sequences for d1th6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1th6a_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russelli pulchella)} sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk c
Timeline for d1th6a_: