Lineage for d1th1b_ (1th1 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006339Protein beta-Catenin [48373] (2 species)
  7. 2006340Species Human (Homo sapiens) [TaxId:9606] [48375] (8 PDB entries)
    Uniprot P35222 145-664
  8. 2006348Domain d1th1b_: 1th1 B: [106906]
    complex with a phosphorylated apc 20aa repeat fragment (Uniprot P25054 1468-1529), chains C and D

Details for d1th1b_

PDB Entry: 1th1 (more details), 2.5 Å

PDB Description: Beta-catenin in complex with a phosphorylated APC 20aa repeat fragment
PDB Compounds: (B:) beta-catenin

SCOPe Domain Sequences for d1th1b_:

Sequence, based on SEQRES records: (download)

>d1th1b_ a.118.1.1 (B:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}
aelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqnt
ndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllh
qegakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalv
nimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtl
rnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggie
alvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwp
likatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrtsmggtqqqfvegvr
meeivegctgalhilardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdk
eaaeaieaegatapltellhsrnegvatyaaavlfrmse

Sequence, based on observed residues (ATOM records): (download)

>d1th1b_ a.118.1.1 (B:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}
aelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqnt
ndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllh
qegakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalv
nimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtl
rnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggie
alvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwp
likatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrtsqfvegvrmeeive
gctgalhilardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaeai
eaegatapltellhsrnegvatyaaavlfrmse

SCOPe Domain Coordinates for d1th1b_:

Click to download the PDB-style file with coordinates for d1th1b_.
(The format of our PDB-style files is described here.)

Timeline for d1th1b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1th1a_