SCOPe 2.02: Domain d1th0b_: 1th0 B:

Lineage for d1th0b_ (1th0 B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.7: Adenain-like [54054] (6 proteins)
   Pfam PF02902; Ulp1 protease family

6. Protein Sentrin-specific protease 2, SENP2 [110771] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110772] (6 PDB entries)
   Uniprot Q9HC62 366-589

8. Domain d1th0b_: 1th0 B: [106904]

Details for d1th0b_

PDB Entry: 1th0, 2.2 Å

PDB Description: Structure of human Senp2

PDB Compounds: (B:) Sentrin-specific protease 2

SCOPe Domain Sequences for d1th0b_:

Sequence; same for both SEQRES and ATOM records:

>d1th0b_ d.3.1.7 (B:) Sentrin-specific protease 2, SENP2 {Human (Homo sapiens) [TaxId: 9606]}
eltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllver
nkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvidl
rkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlngs
dcgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll

Timeline for d1th0b_:

• d1th0b_ first appeared in SCOP 1.69
  
• d1th0b_ appears in SCOPe 2.01
  
• d1th0b_ appears in SCOPe 2.03
  
• d1th0b_ appears in the current release, SCOPe 2.08