Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (12 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.7: Adenain-like [54054] (4 proteins) Pfam 02902; Ulp1 protease family |
Protein Sentrin-specific protease 2, SENP2 [110771] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [110772] (2 PDB entries) |
Domain d1th0b_: 1th0 B: [106904] |
PDB Entry: 1th0 (more details), 2.2 Å
SCOP Domain Sequences for d1th0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1th0b_ d.3.1.7 (B:) Sentrin-specific protease 2, SENP2 {Human (Homo sapiens)} eltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllver nkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvidl rkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlngs dcgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
Timeline for d1th0b_: