Lineage for d1th0a_ (1th0 A:)
- Root: SCOP 1.71
Class d: Alpha and beta proteins (a+b) [53931] (286 folds) 
Fold d.3: Cysteine proteinases [54000] (1 superfamily)
consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-AsnSuperfamily d.3.1: Cysteine proteinases [54001] (12 families) 
the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
Family d.3.1.7: Adenain-like [54054] (4 proteins)
Pfam 02902; Ulp1 protease family
Protein Sentrin-specific protease 2, SENP2 [110771] (1 species) Species Human (Homo sapiens) [TaxId:9606] [110772] (2 PDB entries) 
Domain d1th0a_: 1th0 A: [106903]
Details for d1th0a_
PDB Entry: 1th0 (more details), 2.2 Å
PDB Description: Structure of human Senp2
SCOP Domain Sequences for d1th0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1th0a_ d.3.1.7 (A:) Sentrin-specific protease 2, SENP2 {Human (Homo sapiens)}
dlleltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnll
vernkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvv
idlrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqql
ngsdcgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
SCOP Domain Coordinates for d1th0a_:
Click to download the PDB-style file with coordinates for d1th0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1th0a_:
- d1th0a_ first appeared in SCOP 1.69
- d1th0a_ appears in SCOP 1.73
- d1th0a_ appears in the current release, SCOPe 2.08
View in 3D
