SCOP 1.71: Domain d1tgzb_: 1tgz B:

Lineage for d1tgzb_ (1tgz B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (6 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (26 proteins)
   Pfam 00240

6. Protein SUMO-1 (smt3 homologue) [54241] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54242] (2 PDB entries)

8. Domain d1tgzb_: 1tgz B: [106902]
   Other proteins in same PDB: d1tgza_
   complexed with so4

Details for d1tgzb_

PDB Entry: 1tgz, 2.8 Å

PDB Description: Structure of human Senp2 in complex with SUMO-1

SCOP Domain Sequences for d1tgzb_:

Sequence; same for both SEQRES and ATOM records:

>d1tgzb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Human (Homo sapiens)}
eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke
lgmeeedvievyqeqtgg

Timeline for d1tgzb_:

• d1tgzb_ first appeared in SCOP 1.69
  
• d1tgzb_ appears in SCOP 1.73
  
• d1tgzb_ appears in the current release, SCOPe 2.08