Lineage for d1tgza_ (1tgz A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 597009Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 597010Superfamily d.3.1: Cysteine proteinases [54001] (12 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 597308Family d.3.1.7: Adenain-like [54054] (4 proteins)
    Pfam 02902; Ulp1 protease family
  6. 597313Protein Sentrin-specific protease 2, SENP2 [110771] (1 species)
  7. 597314Species Human (Homo sapiens) [TaxId:9606] [110772] (2 PDB entries)
  8. 597317Domain d1tgza_: 1tgz A: [106901]
    Other proteins in same PDB: d1tgzb_
    complexed with so4

Details for d1tgza_

PDB Entry: 1tgz (more details), 2.8 Å

PDB Description: Structure of human Senp2 in complex with SUMO-1

SCOP Domain Sequences for d1tgza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tgza_ d.3.1.7 (A:) Sentrin-specific protease 2, SENP2 {Human (Homo sapiens)}
leltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllve
rnkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvid
lrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlng
sdcgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll

SCOP Domain Coordinates for d1tgza_:

Click to download the PDB-style file with coordinates for d1tgza_.
(The format of our PDB-style files is described here.)

Timeline for d1tgza_: