Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (11 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.7: Adenain-like [54054] (3 proteins) |
Protein Sentrin-specific protease 2, SENP2 [110771] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [110772] (2 PDB entries) |
Domain d1tgza_: 1tgz A: [106901] Other proteins in same PDB: d1tgzb_ |
PDB Entry: 1tgz (more details), 2.8 Å
SCOP Domain Sequences for d1tgza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tgza_ d.3.1.7 (A:) Sentrin-specific protease 2, SENP2 {Human (Homo sapiens)} leltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllve rnkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvid lrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlng sdcgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
Timeline for d1tgza_: