![]() | Class f: Membrane and cell surface proteins and peptides [56835] (47 folds) |
![]() | Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
![]() | Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (1 family) ![]() |
![]() | Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (2 proteins) |
![]() | Protein Envelope glycoprotein [56985] (2 species) |
![]() | Species Dengue virus type 2 [TaxId:12637] [90131] (6 PDB entries) |
![]() | Domain d1tgeb2: 1tge B:1-297 [106897] Other proteins in same PDB: d1tgea1, d1tgeb1, d1tgec1 |
PDB Entry: 1tge (more details)
SCOP Domain Sequences for d1tgeb2:
Sequence, based on SEQRES records: (download)
>d1tgeb2 f.10.1.1 (B:1-297) Envelope glycoprotein {Dengue virus type 2} mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc ieakltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm
>d1tgeb2 f.10.1.1 (B:1-297) Envelope glycoprotein {Dengue virus type 2} mrcigisnrdfvegvsswvdivlehgscvttmaknkptldfelikteakqpatlrkycie akltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamftck knmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygtvt mecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgagsnwiqketlvtfknpha kkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm
Timeline for d1tgeb2:
![]() Domains from other chains: (mouse over for more information) d1tgea1, d1tgea2, d1tgec1, d1tgec2 |