Lineage for d1tgea2 (1tge A:1-297)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519458Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 519459Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (1 family) (S)
  5. 519460Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (2 proteins)
  6. 519461Protein Envelope glycoprotein [56985] (2 species)
  7. 519462Species Dengue virus type 2 [TaxId:12637] [90131] (6 PDB entries)
  8. 519472Domain d1tgea2: 1tge A:1-297 [106895]
    Other proteins in same PDB: d1tgea1, d1tgeb1, d1tgec1

Details for d1tgea2

PDB Entry: 1tge (more details)

PDB Description: the structure of immature dengue virus at 12.5 angstrom

SCOP Domain Sequences for d1tgea2:

Sequence, based on SEQRES records: (download)

>d1tgea2 f.10.1.1 (A:1-297) Envelope glycoprotein {Dengue virus type 2}
mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
ieakltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft
ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt
vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm

Sequence, based on observed residues (ATOM records): (download)

>d1tgea2 f.10.1.1 (A:1-297) Envelope glycoprotein {Dengue virus type 2}
mrcigisnrdfvegvsswvdivlehgscvttmaknkptldfelikteakqpatlrkycie
akltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamftck
knmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygtvt
mecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgagsnwiqketlvtfknpha
kkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm

SCOP Domain Coordinates for d1tgea2:

Click to download the PDB-style file with coordinates for d1tgea2.
(The format of our PDB-style files is described here.)

Timeline for d1tgea2: