Lineage for d1tg8a2 (1tg8 A:1-297)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2225037Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 2225038Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 2225039Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (3 protein domains)
  6. 2225040Protein Envelope glycoprotein [56985] (2 species)
  7. 2225041Species Dengue virus type 2 [TaxId:11060] [90131] (8 PDB entries)
    Uniprot P12823 281-675
  8. 2225045Domain d1tg8a2: 1tg8 A:1-297 [106893]
    Other proteins in same PDB: d1tg8a1
    complexed with ndg

Details for d1tg8a2

PDB Entry: 1tg8 (more details), 2.61 Å

PDB Description: The structure of Dengue virus E glycoprotein
PDB Compounds: (A:) Envelope glycoprotein

SCOPe Domain Sequences for d1tg8a2:

Sequence, based on SEQRES records: (download)

>d1tg8a2 f.10.1.1 (A:1-297) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
ieakltntttdsrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft
ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt
vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm

Sequence, based on observed residues (ATOM records): (download)

>d1tg8a2 f.10.1.1 (A:1-297) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
mrcigisnrdfvegvsswvdivlehgscvttmaknkptldfelikteakqpatlrkycie
akltntttdsrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamftck
knmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygtvt
mecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgagsnwiqketlvtfknpha
kkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm

SCOPe Domain Coordinates for d1tg8a2:

Click to download the PDB-style file with coordinates for d1tg8a2.
(The format of our PDB-style files is described here.)

Timeline for d1tg8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tg8a1