Lineage for d1tg5a2 (1tg5 A:196-410)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1900809Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 1900810Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 1900969Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 1901005Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species)
  7. 1901037Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110877] (4 PDB entries)
    Uniprot P93836 33-428 ! Uniprot P93836 63-459
  8. 1901041Domain d1tg5a2: 1tg5 A:196-410 [106891]
    complexed with 645, fe2

Details for d1tg5a2

PDB Entry: 1tg5 (more details), 1.9 Å

PDB Description: crystal structures of plant 4-hydroxyphenylpyruvate dioxygenases complexed with das645
PDB Compounds: (A:) 4-hydroxyphenylpyruvate dioxygenase

SCOPe Domain Sequences for d1tg5a2:

Sequence, based on SEQRES records: (download)

>d1tg5a2 d.32.1.3 (A:196-410) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ldygirrldhavgnvpelgpaltyvagftgfhqfaeftaddvgtaesglnsavlasndem
vllpinepvhgtkrksqiqtylehnegaglqhlalmsedifrtlremrkrssiggfdfmp
sppptyyqnlkkrvgdvlsddqikeceelgilvdrddqgtllqiftkplgdrptifieii
qrvgcmmkdeegkayqsggcggfgkgnfselfksi

Sequence, based on observed residues (ATOM records): (download)

>d1tg5a2 d.32.1.3 (A:196-410) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ldygirrldhavgnvpelgpaltyvagftgfhqfaesglnsavlasndemvllpinepvh
gtksqiqtylehnegaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkk
rvgdvlsddqikeceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcyqsggcg
gfgkgnfselfksi

SCOPe Domain Coordinates for d1tg5a2:

Click to download the PDB-style file with coordinates for d1tg5a2.
(The format of our PDB-style files is described here.)

Timeline for d1tg5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tg5a1