SCOP 1.75: Domain d1tg5a1: 1tg5 A:14-180

Lineage for d1tg5a1 (1tg5 A:14-180)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (10 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (5 species)

7. Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [110877] (4 PDB entries)
   Uniprot P93836 33-428
   Uniprot P93836 63-459
   Uniprot P93836 33-428 ! Uniprot P93836 63-459

8. Domain d1tg5a1: 1tg5 A:14-180 [106890]

Details for d1tg5a1

PDB Entry: 1tg5, 1.9 Å

PDB Description: crystal structures of plant 4-hydroxyphenylpyruvate dioxygenases complexed with das645

PDB Compounds: (A:) 4-hydroxyphenylpyruvate dioxygenase

SCOP Domain Sequences for d1tg5a1:

Sequence, based on SEQRES records:

>d1tg5a1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}
knpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasylltsgd
lrflftapyspslsageikptttasipsfdhgscrsffsshglgvravaievedaesafs
isvangaipssppivlneavtiaevklygdvvlryvsykaedtekse

Sequence, based on observed residues (ATOM records):

>d1tg5a1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}
knpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasylltsgd
lrflftapyspslsageikptttasipsfdhgscrsffsshglgvravaievedaesafs
isvangaipssppivlneavtiaevklygdvvlryvsykase

Timeline for d1tg5a1:

• d1tg5a1 first appeared in SCOP 1.69
  
• d1tg5a1 appears in SCOP 1.73
  
• d1tg5a1 appears in SCOPe 2.01
  
• d1tg5a1 appears in the current release, SCOPe 2.08