Class a: All alpha proteins [46456] (289 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
Protein Snake phospholipase A2 [48624] (38 species) |
Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (39 PDB entries) Uniprot P59071 |
Domain d1tg4a_: 1tg4 A: [106889] complexed with so4 |
PDB Entry: 1tg4 (more details), 1.7 Å
SCOPe Domain Sequences for d1tg4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tg4a_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]} sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk c
Timeline for d1tg4a_: