Lineage for d1tg4a_ (1tg4 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011697Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2011698Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2011703Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 protein domains)
    automatically mapped to Pfam PF00068
  6. 2011813Protein Snake phospholipase A2 [48624] (37 species)
  7. 2012007Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (38 PDB entries)
    Uniprot P59071
  8. 2012024Domain d1tg4a_: 1tg4 A: [106889]
    complexed with so4

Details for d1tg4a_

PDB Entry: 1tg4 (more details), 1.7 Å

PDB Description: Design of specific inhibitors of groupII phospholipase A2(PLA2): Crystal structure of the complex formed between russells viper PLA2 and designed peptide Phe-Leu-Ala-Tyr-Lys at 1.7A resolution
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1tg4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tg4a_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOPe Domain Coordinates for d1tg4a_:

Click to download the PDB-style file with coordinates for d1tg4a_.
(The format of our PDB-style files is described here.)

Timeline for d1tg4a_: