Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (10 families) |
Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins) duplication: consists of 2 similar domains with 2 repeats in each Similar to the Methylmalonyl-CoA epimerase dimer |
Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (5 species) |
Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [110877] (4 PDB entries) Uniprot P93836 33-428 Uniprot P93836 63-459 Uniprot P93836 33-428 ! Uniprot P93836 63-459 |
Domain d1tfza1: 1tfz A:15-180 [106886] |
PDB Entry: 1tfz (more details), 1.8 Å
SCOP Domain Sequences for d1tfza1:
Sequence, based on SEQRES records: (download)
>d1tfza1 d.32.1.3 (A:15-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} npksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasylltsgdl rflftapyspslsageikptttasipsfdhgscrsffsshglgvravaievedaesafsi svangaipssppivlneavtiaevklygdvvlryvsykaedtekse
>d1tfza1 d.32.1.3 (A:15-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} npksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasylltsgdl rflftapyspslsageikptttasipsfdhgscrsffsshglgvravaievedaesafsi svangaipssppivlneavtiaevklygdvvlryvsyke
Timeline for d1tfza1: