Lineage for d1tfza1 (1tfz A:15-180)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 601425Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 601426Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (9 families) (S)
  5. 601513Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 601549Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (5 species)
  7. 601564Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [110877] (4 PDB entries)
  8. 601567Domain d1tfza1: 1tfz A:15-180 [106886]

Details for d1tfza1

PDB Entry: 1tfz (more details), 1.8 Å

PDB Description: structural basis for herbicidal inhibitor selectivity revealed by comparison of crystal structures of plant and mammalian 4- hydroxyphenylpyruvate dioxygenases

SCOP Domain Sequences for d1tfza1:

Sequence, based on SEQRES records: (download)

>d1tfza1 d.32.1.3 (A:15-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana)}
npksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasylltsgdl
rflftapyspslsageikptttasipsfdhgscrsffsshglgvravaievedaesafsi
svangaipssppivlneavtiaevklygdvvlryvsykaedtekse

Sequence, based on observed residues (ATOM records): (download)

>d1tfza1 d.32.1.3 (A:15-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana)}
npksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasylltsgdl
rflftapyspslsageikptttasipsfdhgscrsffsshglgvravaievedaesafsi
svangaipssppivlneavtiaevklygdvvlryvsyke

SCOP Domain Coordinates for d1tfza1:

Click to download the PDB-style file with coordinates for d1tfza1.
(The format of our PDB-style files is described here.)

Timeline for d1tfza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tfza2