![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (3 families) ![]() |
![]() | Family d.58.16.2: Archaeal tRNA CCA-adding enzyme [102995] (2 proteins) decorated fold with a large insertion |
![]() | Protein tRNA nucleotidyltransferase, C-terminal domain [102996] (1 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [102997] (26 PDB entries) Uniprot O28126 |
![]() | Domain d1tfyd3: 1tfy D:258-437 [106885] Other proteins in same PDB: d1tfya1, d1tfya2, d1tfyb1, d1tfyb2, d1tfyc1, d1tfyc2, d1tfyd1, d1tfyd2 protein/RNA complex; complexed with ctp, mg |
PDB Entry: 1tfy (more details), 3.2 Å
SCOPe Domain Sequences for d1tfyd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tfyd3 d.58.16.2 (D:258-437) tRNA nucleotidyltransferase, C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} hpleieperlrkiveergtavfavkfrkpdivddnlypqlerasrkifeflerenfmplr safkaseefcyllfecqikeisrvfrrmgpqfedernvkkflsrnrafrpfiengrwwaf emrkfttpeegvrsyasthwhtlgknvgesireyfeiisgeklfkepvtaelcemmgvkd
Timeline for d1tfyd3: