Lineage for d1tfyc2 (1tfy C:1-142)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 880450Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 880451Superfamily d.218.1: Nucleotidyltransferase [81301] (14 families) (S)
  5. 880677Family d.218.1.7: Archaeal tRNA CCA-adding enzyme catalytic domain [102940] (1 protein)
    similar overall structure to poly(A) polymerase, PAP
  6. 880678Protein tRNA nucleotidyltransferase, N-terminal domain [102941] (1 species)
  7. 880679Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102942] (28 PDB entries)
    Uniprot O28126
  8. 880711Domain d1tfyc2: 1tfy C:1-142 [106881]
    Other proteins in same PDB: d1tfya1, d1tfya3, d1tfyb1, d1tfyb3, d1tfyc1, d1tfyc3, d1tfyd1, d1tfyd3

Details for d1tfyc2

PDB Entry: 1tfy (more details), 3.2 Å

PDB Description: How CCA is added to the 3' end of immature tRNA without the use of an oligonucleotide template
PDB Compounds: (C:) tRNA nucleotidyltransferase

SCOP Domain Sequences for d1tfyc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfyc2 d.218.1.7 (C:1-142) tRNA nucleotidyltransferase, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
mkveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgslei
dvfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkep
kniksavdrtpfhhkwlegrik

SCOP Domain Coordinates for d1tfyc2:

Click to download the PDB-style file with coordinates for d1tfyc2.
(The format of our PDB-style files is described here.)

Timeline for d1tfyc2: