Lineage for d1tfyb3 (1tfy B:258-437)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196795Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (3 families) (S)
  5. 2196811Family d.58.16.2: Archaeal tRNA CCA-adding enzyme [102995] (2 proteins)
    decorated fold with a large insertion
  6. 2196812Protein tRNA nucleotidyltransferase, C-terminal domain [102996] (1 species)
  7. 2196813Species Archaeoglobus fulgidus [TaxId:2234] [102997] (26 PDB entries)
    Uniprot O28126
  8. 2196842Domain d1tfyb3: 1tfy B:258-437 [106879]
    Other proteins in same PDB: d1tfya1, d1tfya2, d1tfyb1, d1tfyb2, d1tfyc1, d1tfyc2, d1tfyd1, d1tfyd2
    protein/RNA complex; complexed with ctp, mg

Details for d1tfyb3

PDB Entry: 1tfy (more details), 3.2 Å

PDB Description: How CCA is added to the 3' end of immature tRNA without the use of an oligonucleotide template
PDB Compounds: (B:) tRNA nucleotidyltransferase

SCOPe Domain Sequences for d1tfyb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfyb3 d.58.16.2 (B:258-437) tRNA nucleotidyltransferase, C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
hpleieperlrkiveergtavfavkfrkpdivddnlypqlerasrkifeflerenfmplr
safkaseefcyllfecqikeisrvfrrmgpqfedernvkkflsrnrafrpfiengrwwaf
emrkfttpeegvrsyasthwhtlgknvgesireyfeiisgeklfkepvtaelcemmgvkd

SCOPe Domain Coordinates for d1tfyb3:

Click to download the PDB-style file with coordinates for d1tfyb3.
(The format of our PDB-style files is described here.)

Timeline for d1tfyb3: