Lineage for d1tfyb2 (1tfy B:1-142)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006866Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 3006867Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 3007239Family d.218.1.7: Archaeal tRNA CCA-adding enzyme catalytic domain [102940] (1 protein)
    similar overall structure to poly(A) polymerase, PAP
  6. 3007240Protein tRNA nucleotidyltransferase, N-terminal domain [102941] (1 species)
  7. 3007241Species Archaeoglobus fulgidus [TaxId:2234] [102942] (26 PDB entries)
    Uniprot O28126
  8. 3007269Domain d1tfyb2: 1tfy B:1-142 [106878]
    Other proteins in same PDB: d1tfya1, d1tfya3, d1tfyb1, d1tfyb3, d1tfyc1, d1tfyc3, d1tfyd1, d1tfyd3
    protein/RNA complex; complexed with ctp, mg

Details for d1tfyb2

PDB Entry: 1tfy (more details), 3.2 Å

PDB Description: How CCA is added to the 3' end of immature tRNA without the use of an oligonucleotide template
PDB Compounds: (B:) tRNA nucleotidyltransferase

SCOPe Domain Sequences for d1tfyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfyb2 d.218.1.7 (B:1-142) tRNA nucleotidyltransferase, N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
mkveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgslei
dvfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkep
kniksavdrtpfhhkwlegrik

SCOPe Domain Coordinates for d1tfyb2:

Click to download the PDB-style file with coordinates for d1tfyb2.
(The format of our PDB-style files is described here.)

Timeline for d1tfyb2: