SCOP 1.73: Domain d1tfyb1: 1tfy B:143-257

Lineage for d1tfyb1 (1tfy B:143-257)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
   core: 5-helical bundle; up-and-down; right-handed twist

4. Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (4 families)
   this domain follows the catalytic nucleotidyltransferase domain

5. Family a.160.1.3: Archaeal tRNA CCA-adding enzyme substrate-binding domain [101274] (1 protein)

6. Protein tRNA nucleotidyltransferase, second domain [101275] (1 species)

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [101276] (17 PDB entries)

8. Domain d1tfyb1: 1tfy B:143-257 [106877]
   Other proteins in same PDB: d1tfya2, d1tfya3, d1tfyb2, d1tfyb3, d1tfyc2, d1tfyc3, d1tfyd2, d1tfyd3

Details for d1tfyb1

PDB Entry: 1tfy, 3.2 Å

PDB Description: How CCA is added to the 3' end of immature tRNA without the use of an oligonucleotide template

PDB Compounds: (B:) tRNA nucleotidyltransferase

SCOP Domain Sequences for d1tfyb1:

Sequence; same for both SEQRES and ATOM records:

>d1tfyb1 a.160.1.3 (B:143-257) tRNA nucleotidyltransferase, second domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
gkenevrllkgflkangiygaeykvrgfsgylcellivfygsfletvknarrwtrrtvid
vakgevrkgeeffvvdpvdekrnvaanlsldnlarfvhlcrefmeapslgffkpk

Timeline for d1tfyb1:

• d1tfyb1 first appeared in SCOP 1.69
  
• d1tfyb1 appears in SCOP 1.71
  
• d1tfyb1 appears in SCOP 1.75
  
• d1tfyb1 appears in the current release, SCOPe 2.08