Lineage for d1tfwd3 (1tfw D:258-437)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560667Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (3 families) (S)
  5. 2560683Family d.58.16.2: Archaeal tRNA CCA-adding enzyme [102995] (2 proteins)
    decorated fold with a large insertion
  6. 2560684Protein tRNA nucleotidyltransferase, C-terminal domain [102996] (1 species)
  7. 2560685Species Archaeoglobus fulgidus [TaxId:2234] [102997] (26 PDB entries)
    Uniprot O28126
  8. 2560695Domain d1tfwd3: 1tfw D:258-437 [106873]
    Other proteins in same PDB: d1tfwa1, d1tfwa2, d1tfwb1, d1tfwb2, d1tfwc1, d1tfwc2, d1tfwd1, d1tfwd2
    protein/RNA complex; complexed with atp, mg

Details for d1tfwd3

PDB Entry: 1tfw (more details), 2.2 Å

PDB Description: How CCA is added to the 3' end of immature tRNA without the use of an oligonucleotide template
PDB Compounds: (D:) tRNA nucleotidyltransferase

SCOPe Domain Sequences for d1tfwd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfwd3 d.58.16.2 (D:258-437) tRNA nucleotidyltransferase, C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
hpleieperlrkiveergtavfavkfrkpdivddnlypqlerasrkifeflerenfmplr
safkaseefcyllfecqikeisrvfrrmgpqfedernvkkflsrnrafrpfiengrwwaf
emrkfttpeegvrsyasthwhtlgknvgesireyfeiisgeklfkepvtaelcemmgvkd

SCOPe Domain Coordinates for d1tfwd3:

Click to download the PDB-style file with coordinates for d1tfwd3.
(The format of our PDB-style files is described here.)

Timeline for d1tfwd3: