Lineage for d1tfwd1 (1tfw D:143-257)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650456Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
    core: 5-helical bundle; up-and-down; right-handed twist
  4. 650457Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (4 families) (S)
    this domain follows the catalytic nucleotidyltransferase domain
  5. 650475Family a.160.1.3: Archaeal tRNA CCA-adding enzyme substrate-binding domain [101274] (1 protein)
  6. 650476Protein tRNA nucleotidyltransferase, second domain [101275] (1 species)
  7. 650477Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [101276] (17 PDB entries)
  8. 650487Domain d1tfwd1: 1tfw D:143-257 [106871]
    Other proteins in same PDB: d1tfwa2, d1tfwa3, d1tfwb2, d1tfwb3, d1tfwc2, d1tfwc3, d1tfwd2, d1tfwd3
    complexed with atp, mg

Details for d1tfwd1

PDB Entry: 1tfw (more details), 2.2 Å

PDB Description: How CCA is added to the 3' end of immature tRNA without the use of an oligonucleotide template
PDB Compounds: (D:) tRNA nucleotidyltransferase

SCOP Domain Sequences for d1tfwd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfwd1 a.160.1.3 (D:143-257) tRNA nucleotidyltransferase, second domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
gkenevrllkgflkangiygaeykvrgfsgylcellivfygsfletvknarrwtrrtvid
vakgevrkgeeffvvdpvdekrnvaanlsldnlarfvhlcrefmeapslgffkpk

SCOP Domain Coordinates for d1tfwd1:

Click to download the PDB-style file with coordinates for d1tfwd1.
(The format of our PDB-style files is described here.)

Timeline for d1tfwd1: