Lineage for d1tfwc2 (1tfw C:1-142)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 616179Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 616180Superfamily d.218.1: Nucleotidyltransferase [81301] (9 families) (S)
  5. 616359Family d.218.1.7: Archaeal tRNA CCA-adding enzyme catalytic domain [102940] (1 protein)
    similar overall structure to poly(A) polymerase, PAP
  6. 616360Protein tRNA nucleotidyltransferase, N-terminal domain [102941] (1 species)
  7. 616361Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102942] (10 PDB entries)
  8. 616370Domain d1tfwc2: 1tfw C:1-142 [106869]
    Other proteins in same PDB: d1tfwa1, d1tfwa3, d1tfwb1, d1tfwb3, d1tfwc1, d1tfwc3, d1tfwd1, d1tfwd3

Details for d1tfwc2

PDB Entry: 1tfw (more details), 2.2 Å

PDB Description: How CCA is added to the 3' end of immature tRNA without the use of an oligonucleotide template

SCOP Domain Sequences for d1tfwc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfwc2 d.218.1.7 (C:1-142) tRNA nucleotidyltransferase, N-terminal domain {Archaeon Archaeoglobus fulgidus}
mkveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgslei
dvfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkep
kniksavdrtpfhhkwlegrik

SCOP Domain Coordinates for d1tfwc2:

Click to download the PDB-style file with coordinates for d1tfwc2.
(The format of our PDB-style files is described here.)

Timeline for d1tfwc2: