Lineage for d1tfwc1 (1tfw C:143-257)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017952Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
    core: 5-helical bundle; up-and-down; right-handed twist
  4. 2017953Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families) (S)
    this domain follows the catalytic nucleotidyltransferase domain
  5. 2017978Family a.160.1.3: Archaeal tRNA CCA-adding enzyme substrate-binding domain [101274] (1 protein)
    automatically mapped to Pfam PF09249
  6. 2017979Protein tRNA nucleotidyltransferase, second domain [101275] (1 species)
  7. 2017980Species Archaeoglobus fulgidus [TaxId:2234] [101276] (26 PDB entries)
    Uniprot O28126
  8. 2017989Domain d1tfwc1: 1tfw C:143-257 [106868]
    Other proteins in same PDB: d1tfwa2, d1tfwa3, d1tfwb2, d1tfwb3, d1tfwc2, d1tfwc3, d1tfwd2, d1tfwd3
    protein/RNA complex; complexed with atp, mg

Details for d1tfwc1

PDB Entry: 1tfw (more details), 2.2 Å

PDB Description: How CCA is added to the 3' end of immature tRNA without the use of an oligonucleotide template
PDB Compounds: (C:) tRNA nucleotidyltransferase

SCOPe Domain Sequences for d1tfwc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfwc1 a.160.1.3 (C:143-257) tRNA nucleotidyltransferase, second domain {Archaeoglobus fulgidus [TaxId: 2234]}
gkenevrllkgflkangiygaeykvrgfsgylcellivfygsfletvknarrwtrrtvid
vakgevrkgeeffvvdpvdekrnvaanlsldnlarfvhlcrefmeapslgffkpk

SCOPe Domain Coordinates for d1tfwc1:

Click to download the PDB-style file with coordinates for d1tfwc1.
(The format of our PDB-style files is described here.)

Timeline for d1tfwc1: