SCOP 1.69: Domain d1tfwa1: 1tfw A:143-257

Lineage for d1tfwa1 (1tfw A:143-257)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
   core: 5-helical bundle; up-and-down; right-handed twist

4. Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (3 families)
   this domain follows the catalytic nucleotidyltransferase domain

5. Family a.160.1.3: Archaeal tRNA CCA-adding enzyme substrate-binding domain [101274] (1 protein)

6. Protein tRNA nucleotidyltransferase, second domain [101275] (1 species)

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [101276] (10 PDB entries)

8. Domain d1tfwa1: 1tfw A:143-257 [106862]
   Other proteins in same PDB: d1tfwa2, d1tfwa3, d1tfwb2, d1tfwb3, d1tfwc2, d1tfwc3, d1tfwd2, d1tfwd3

Details for d1tfwa1

PDB Entry: 1tfw, 2.2 Å

PDB Description: How CCA is added to the 3' end of immature tRNA without the use of an oligonucleotide template

SCOP Domain Sequences for d1tfwa1:

Sequence; same for both SEQRES and ATOM records:

>d1tfwa1 a.160.1.3 (A:143-257) tRNA nucleotidyltransferase, second domain {Archaeon Archaeoglobus fulgidus}
gkenevrllkgflkangiygaeykvrgfsgylcellivfygsfletvknarrwtrrtvid
vakgevrkgeeffvvdpvdekrnvaanlsldnlarfvhlcrefmeapslgffkpk

Timeline for d1tfwa1:

• d1tfwa1 is new in SCOP 1.69
  
• d1tfwa1 appears in SCOP 1.71
  
• d1tfwa1 appears in the current release, SCOPe 2.08