Lineage for d1tfva2 (1tfv A:240-307)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1199823Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1200057Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 1200058Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 1200198Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
    secreted during involution
  7. 1200199Species Buffalo (Bubalus bubalis) [TaxId:89462] [110873] (3 PDB entries)
    Uniprot Q7YS85
  8. 1200202Domain d1tfva2: 1tfv A:240-307 [106861]
    Other proteins in same PDB: d1tfva1
    complexed with nag

Details for d1tfva2

PDB Entry: 1tfv (more details), 2.9 Å

PDB Description: crystal structure of a buffalo signaling glycoprotein (spb-40) secreted during involution
PDB Compounds: (A:) mammary gland protein 40

SCOPe Domain Sequences for d1tfva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfva2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Buffalo (Bubalus bubalis) [TaxId: 89462]}
grsytlassktdvgapisgpgipgrftkwkgilayyeicdflhgatthrfrdqqvpyatk
gnqwvayd

SCOPe Domain Coordinates for d1tfva2:

Click to download the PDB-style file with coordinates for d1tfva2.
(The format of our PDB-style files is described here.)

Timeline for d1tfva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tfva1