![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) ![]() |
![]() | Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
![]() | Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species) secreted during involution |
![]() | Species Buffalo (Bubalus bubalis) [TaxId:89462] [110873] (3 PDB entries) Uniprot Q7YS85 |
![]() | Domain d1tfva2: 1tfv A:240-307 [106861] Other proteins in same PDB: d1tfva1 complexed with nag |
PDB Entry: 1tfv (more details), 2.9 Å
SCOPe Domain Sequences for d1tfva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tfva2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Buffalo (Bubalus bubalis) [TaxId: 89462]} grsytlassktdvgapisgpgipgrftkwkgilayyeicdflhgatthrfrdqqvpyatk gnqwvayd
Timeline for d1tfva2: