Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.5: Type II chitinase [51534] (15 proteins) glycosylase family 18 |
Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species) secreted during involution |
Species Buffalo (Bubalus bubalis) [TaxId:89462] [110353] (9 PDB entries) Uniprot Q7YS85 |
Domain d1tfva1: 1tfv A:1-239,A:308-361 [106860] Other proteins in same PDB: d1tfva2 complexed with nag |
PDB Entry: 1tfv (more details), 2.9 Å
SCOPe Domain Sequences for d1tfva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tfva1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Buffalo (Bubalus bubalis) [TaxId: 89462]} yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln tlknrnpnlktllsvggwnygsqrfskiasktqsrrtfiksvppflrthgfdgldlawlw pgwrdkrhlttlvkemkaefvreaqagteqlllsaavtagkiaidrgydiaqisrhldfi slltydfhgawrqtvghhsplfrgnedassrfsnadyavsymlrlgapanklvmgiptfX dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsaikdvlarv
Timeline for d1tfva1: