Lineage for d1tfva1 (1tfv A:1-239,A:308-361)
- Root: SCOP 1.71
Class c: Alpha and beta proteins (a/b) [51349] (134 folds) Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) 
Family c.1.8.5: Type II chitinase [51534] (14 proteins)
glycosylase family 18
Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species)
secreted during involution
Species Buffalo (Bubalus bubalis) [TaxId:89462] [110353] (1 PDB entry) 
Domain d1tfva1: 1tfv A:1-239,A:308-361 [106860]
Other proteins in same PDB: d1tfva2
complexed with nag
Details for d1tfva1
PDB Entry: 1tfv (more details), 2.9 Å
PDB Description: crystal structure of a buffalo signaling glycoprotein (spb-40) secreted during involution
SCOP Domain Sequences for d1tfva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tfva1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Buffalo (Bubalus bubalis)}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpnlktllsvggwnygsqrfskiasktqsrrtfiksvppflrthgfdgldlawlw
pgwrdkrhlttlvkemkaefvreaqagteqlllsaavtagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfrgnedassrfsnadyavsymlrlgapanklvmgiptfX
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsaikdvlarv
SCOP Domain Coordinates for d1tfva1:
Click to download the PDB-style file with coordinates for d1tfva1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tfva1:
- d1tfva1 first appeared in SCOP 1.69
- d1tfva1 appears in SCOP 1.73
- d1tfva1 appears in the current release, SCOPe 2.08
View in 3D
