Lineage for d1tfqa_ (1tfq A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1967381Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 1967382Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 1967383Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 1967438Protein BIR domains of XIAP [57928] (1 species)
  7. 1967439Species Human (Homo sapiens) [TaxId:9606] [57929] (15 PDB entries)
    Uniprot P98170 241-356
  8. 1967471Domain d1tfqa_: 1tfq A: [106858]
    complexed with 998, zn

Details for d1tfqa_

PDB Entry: 1tfq (more details)

PDB Description: nmr structure of an antagonists of the xiap-caspase-9 interaction complexed to the bir3 domain of xiap
PDB Compounds: (A:) baculoviral iap repeat-containing protein 4

SCOPe Domain Sequences for d1tfqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfqa_ g.52.1.1 (A:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]}
msdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvk
cfhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtt

SCOPe Domain Coordinates for d1tfqa_:

Click to download the PDB-style file with coordinates for d1tfqa_.
(The format of our PDB-style files is described here.)

Timeline for d1tfqa_: