Class g: Small proteins [56992] (75 folds) |
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) |
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (5 proteins) |
Protein BIR domains of XIAP [57928] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57929] (7 PDB entries) |
Domain d1tfqa_: 1tfq A: [106858] |
PDB Entry: 1tfq (more details)
SCOP Domain Sequences for d1tfqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tfqa_ g.52.1.1 (A:) BIR domains of XIAP {Human (Homo sapiens)} msdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvk cfhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtt
Timeline for d1tfqa_: