Lineage for d1tfqa_ (1tfq A:)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 524726Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 524727Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) (S)
  5. 524728Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (5 proteins)
  6. 524758Protein BIR domains of XIAP [57928] (1 species)
  7. 524759Species Human (Homo sapiens) [TaxId:9606] [57929] (7 PDB entries)
  8. 524768Domain d1tfqa_: 1tfq A: [106858]

Details for d1tfqa_

PDB Entry: 1tfq (more details)

PDB Description: nmr structure of an antagonists of the xiap-caspase-9 interaction complexed to the bir3 domain of xiap

SCOP Domain Sequences for d1tfqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfqa_ g.52.1.1 (A:) BIR domains of XIAP {Human (Homo sapiens)}
msdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvk
cfhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtt

SCOP Domain Coordinates for d1tfqa_:

Click to download the PDB-style file with coordinates for d1tfqa_.
(The format of our PDB-style files is described here.)

Timeline for d1tfqa_: